PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g069965.1
Common NameMTR_8g069965
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 799aa    MW: 88730.5 Da    PI: 6.7934
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g069965.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.13.5e-075597347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT  E+e +  a +q G++ +++I ++++  +   q++++++ +
  Medtr8g069965.1 55 AWTRNEEESFFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 97
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.24E-1048102IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-551100IPR009057Homeodomain-like
PROSITE profilePS5129312.8451102IPR017884SANT domain
SMARTSM007177.3E-552100IPR001005SANT/Myb domain
CDDcd001677.38E-55598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MEAEAEILID LNTQLHSETI VSVQNEDPGV STSLANDVIM PQQPAPKKPT RQWAAWTRNE  60
EESFFTALRQ VGKNFEKITS RVQSKNKDQV RHYYYRLVRR MNKHLGPELC LDAKNSKDTN  120
AAMLRWWSLL EKYRFKASKL HLKPRRFKIF LEALEHQLLK DRKKSVRKRP LQGGNCQPPG  180
LNTVSNQARA SGNDSRAIKM ILVESQNIIK LGPSKPPLKR NVSMGVNRSN AKGDSNNSKP  240
TRQRKKSGVI TSAAYKKWEK AAIAGVSLVA DAAEHLERAA TVNEVEHDQE NPGEKCSDPA  300
DHVLPSLRTF PQNHSVDNNV QNIVKLKLQL FPIDEPTRRA LEMEKHNPYL ELTVSTRKKI  360
SSILEHLNRK WGNSSIAVGE LMLFPYGVQK ENLNNYQRWN QESTLSAADI YAVIGSPPIF  420
RLRYGWFSYT EHGVLNMQAP VASSCMVRQS KNGGDSMKDR IVSSPSLPMP STNNYSKEHY  480
VDCGTSTNIN DALTSTSTYL PNTRDGSIYH NTSTEEPCGP TAQISSHGKD ATDGAVTRHL  540
EDMDGLKSTN GSGLSAGEWA DTLTNISVGD LLSGVSQDHN DNCIDPLIAE NCRSVHQIPF  600
SCDSFDAAIA AHISKHQDKM GQSTLASHMS SIWDAEETRD AFSFKKDSII RHEDGPCLSL  660
IASLDSDKKV PERSFENLDK LSPEKESLVD DIAQTDPLPM DGCESDADNK YHSAKDFTGL  720
ADMYWPDSLG PLDLEIPSTK YHSDDPILSD SGLNRLIASS LDAFQNCSFF GIDKKETPST  780
VEAQETATLS NFKIGSGI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013446203.10.0TSL-kinase interacting protein
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A072U3310.0A0A072U331_MEDTR; TSL-kinase interacting protein
STRINGGLYMA16G23840.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98832531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]